PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G332000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 383aa    MW: 40374.5 Da    PI: 6.9296
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G332000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.5e-181360148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg W++eEde+lv++++ +G  +W++++++ g+ R++k+c++rw +yl
  Sevir.2G332000.1.p 13 RGLWSPEEDEKLVKYITAHGHSCWSAVPKHAGLQRCGKSCRLRWINYL 60
                        788*******************************************97 PP

2Myb_DNA-binding49.41e-1566109146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg ++ +E+  ++d+++ lG++ W+ Ia++++ gRt++++k++w++
  Sevir.2G332000.1.p  66 RGTFSDQEERTIIDVHRILGNR-WAQIAKHLP-GRTDNEVKNFWNS 109
                         899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-26463IPR009057Homeodomain-like
PROSITE profilePS5129417.851860IPR017930Myb domain
SuperFamilySSF466899.73E-2810107IPR009057Homeodomain-like
SMARTSM007171.4E-131262IPR001005SANT/Myb domain
PfamPF002499.5E-161360IPR001005SANT/Myb domain
CDDcd001678.47E-121660No hitNo description
PROSITE profilePS5129425.20361115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2464116IPR009057Homeodomain-like
SMARTSM007173.6E-1565113IPR001005SANT/Myb domain
PfamPF002492.8E-1466109IPR001005SANT/Myb domain
CDDcd001673.26E-1168108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MGHHCCSKQK VKRGLWSPEE DEKLVKYITA HGHSCWSAVP KHAGLQRCGK SCRLRWINYL  60
RPDLKRGTFS DQEERTIIDV HRILGNRWAQ IAKHLPGRTD NEVKNFWNSC IKKKLIAQGL  120
DPKTHNLLPA SRSLLHGNGA ANPSNNPAQF HSNGATANGG ATTPFTISSP TKAAAYDTVT  180
APPPPEMSAP AMYDVVTNPA GMFTGHDQAA AAAIPAGYSY PDNGGGVLMS FRDQNAGLQT  240
SMDFMNGSSS SSSMDHAAGM PNGNGFSQGM GAAFMDVTAG MWTTAVDSAM CAGIEVVQQQ  300
QQPLPPLQQP QGLVQGEVIG RPAVMNGGGA AADKGMDMMD VSSVYGSAGA TAFDLELMES  360
CGLFCGGGGG AGNAMEQLQW DC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-33131157108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0040067e-60AP004006.5 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OJ1197_D06.
GenBankAP0042597e-60AP004259.2 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0005E02.
GenBankAP0149637e-60AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankCP0126157e-60CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957753.10.0PREDICTED: transcription factor MYB12-like
TrEMBLK3ZU710.0K3ZU71_SETIT; Uncharacterized protein
STRINGSi030152m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97513545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.14e-82myb domain protein 67